| Basic Information | |
|---|---|
| Taxon OID | 3300011268 Open in IMG/M |
| Scaffold ID | Ga0151620_1189934 Open in IMG/M |
| Source Dataset Name | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Oregon State University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 623 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → The Molecular Ecology Of Microcystis Sp. Blooms In The San Francisco Estuary Delta |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | San Francisco Estuary Delta, California, USA | |||||||
| Coordinates | Lat. (o) | 37.986944 | Long. (o) | -121.523611 | Alt. (m) | Depth (m) | .2 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F007360 | Metagenome / Metatranscriptome | 352 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0151620_11899342 | F007360 | N/A | LMALLDPSSKRDTILITPGSPMPSRIPDGLTVAETSRGIVITSDPAKVKIIDQGSEKDVGMALFGYAYDQAKGFDNVAVAMDRSGIPVAELAIKPGQERRAMRAASLLAPDTGSTNMMSRGDVVNTRLRGLLD* |
| ⦗Top⦘ |