Scaffold Ga0151620_1001386

Overview

Basic Information

• Taxon OID: 3300011268
• Scaffold ID: Ga0151620_1001386
• Source Dataset Name: Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Oregon State University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 9312
• Total Scaffold Genes: 24
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (8.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → The Molecular Ecology Of Microcystis Sp. Blooms In The San Francisco Estuary Delta

Source Dataset Sampling Location

• Location Name: San Francisco Estuary Delta, California, USA
• Coordinates
  • Lat. (^o): 37.986944
  • Long. (^o): -121.523611
  • Depth (m): .2

Associated Families

Family	Category	Number of Sequences	3D Structure?
F023849	Metagenome / Metatranscriptome	208	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0151620_100138618	F023849	N/A	MKTLTLHTNCSQPTLRNEWCGIRMFSTFSNPAQANLGKVDYISTGLEDDTDVG*