| Basic Information | |
|---|---|
| Taxon OID | 3300011264 Open in IMG/M |
| Scaffold ID | Ga0151623_1150507 Open in IMG/M |
| Source Dataset Name | Acid mine drainage microbial communities from Malanjkhand copper mine, India - M16 k-mer 63 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Xcelris labs Ltd |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2487 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Groundwater → Acid Mine Drainage → Sediment → Acid Mine Drainage Microbial Communities From Malanjkhand Copper Mine, India |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Malanjkhand , India | |||||||
| Coordinates | Lat. (o) | 22.023017 | Long. (o) | 80.732183 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F052355 | Metagenome | 142 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0151623_11505072 | F052355 | GAG | MGLSQRELLLEMREDIRGLKATVDEIARDQALGAERRANMQRSADAIYARLDAHDRDLDRMQAWQNRADGAMVLARWALGASLVSLLAVGMQLVAALAKAVNPSLP* |
| ⦗Top⦘ |