NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0151661_1143694

Scaffold Ga0151661_1143694


Overview

Basic Information
Taxon OID3300011261 Open in IMG/M
Scaffold IDGa0151661_1143694 Open in IMG/M
Source Dataset NameMarine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_4, 0.02
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterToyama Prefectural University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)647
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Sediment → Marine → Environmental Dna From Seawater And Marine Sediment

Source Dataset Sampling Location
Location NameJapan Sea near Toyama Prefecture, JAPAN
CoordinatesLat. (o)37.36023Long. (o)137.9591Alt. (m)Depth (m)570
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F033962Metagenome / Metatranscriptome176N

Sequences

Protein IDFamilyRBSSequence
Ga0151661_11436942F033962N/AMTMNELKEYVANQKRIKVAQWNKQREGNYCQSFTQKEFEQTKEVDRIKTRTHRTHSKGNLWNYYHTKDRELFTK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.