Scaffold Ga0151677_1013314

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0151677_1013314

Scaffold Ga0151677_1013314

Overview

Basic Information
Taxon OID	3300011258 Open in IMG/M
Scaffold ID	Ga0151677_1013314 Open in IMG/M
Source Dataset Name	Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeate
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Toyama Prefectural University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	565
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Environmental Dna From Seawater And Marine Sediment

Source Dataset Sampling Location
Location Name	Japan Sea near Toyama Prefecture, JAPAN
Coordinates	Lat. (^o)	36.97018	Long. (^o)	137.37008	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F101879	Metagenome	102	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0151677_10133142	F101879	N/A	EVELDERIQASYKMFSQSDESHVMYRIQGQIHALQALKQLRLKVNANG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.