NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0151664_1101265

Scaffold Ga0151664_1101265


Overview

Basic Information
Taxon OID3300011256 Open in IMG/M
Scaffold IDGa0151664_1101265 Open in IMG/M
Source Dataset NameMarine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_4, total
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterToyama Prefectural University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)536
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Sediment → Marine → Environmental Dna From Seawater And Marine Sediment

Source Dataset Sampling Location
Location NameJapan Sea near Toyama Prefecture, JAPAN
CoordinatesLat. (o)37.36023Long. (o)137.9591Alt. (m)Depth (m)570
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008307Metagenome / Metatranscriptome335Y
F043149Metagenome / Metatranscriptome157N

Sequences

Protein IDFamilyRBSSequence
Ga0151664_11012651F043149AGGAGMSLRNSNTRLYNKLDAAHKKVYAAKDKGRQCVHTLKAFKEYNQLFRRIVEAEN
Ga0151664_11012652F008307AGCAGMVKVLKISSLELAVDFEEIFDGASVEEATQKAHSQKMPSEFAKASITDNKLISANIKIIGEENDELKK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.