Basic Information | |
---|---|
Taxon OID | 3300011254 Open in IMG/M |
Scaffold ID | Ga0151675_1105524 Open in IMG/M |
Source Dataset Name | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, 0.02 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Toyama Prefectural University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 585 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Environmental Dna From Seawater And Marine Sediment |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Japan Sea near Toyama Prefecture, JAPAN | |||||||
Coordinates | Lat. (o) | 36.97018 | Long. (o) | 137.37008 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F043631 | Metagenome | 156 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0151675_11055242 | F043631 | AGGAG | MAKETIEETKEEMINRLKVELGDYLHETYEVQCLFHGKITGTFNKFLNRPSGCKQCIKHGLKAWDKDFHQGIIWQAIHKLIADNKLAIKQAEAEELENASI* |
⦗Top⦘ |