Scaffold Ga0151675_1055623

Overview

Basic Information

• Taxon OID: 3300011254
• Scaffold ID: Ga0151675_1055623
• Source Dataset Name: Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, 0.02
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Toyama Prefectural University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 575
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Bowmanella → unclassified Bowmanella → Bowmanella sp. JS7-9 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Environmental Dna From Seawater And Marine Sediment

Source Dataset Sampling Location

• Location Name: Japan Sea near Toyama Prefecture, JAPAN
• Coordinates
  • Lat. (^o): 36.97018
  • Long. (^o): 137.37008

Associated Families

Family	Category	Number of Sequences	3D Structure?
F016661	Metagenome	245	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0151675_10556232	F016661	GAGG	MNYSAERYLALKQFEREQKRDKIRALLWNVSIGSIYAMVVIQVFTGVL*