NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0151675_1007736

Scaffold Ga0151675_1007736


Overview

Basic Information
Taxon OID3300011254 Open in IMG/M
Scaffold IDGa0151675_1007736 Open in IMG/M
Source Dataset NameSeawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, 0.02
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterToyama Prefectural University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2190
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (62.50%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Environmental Dna From Seawater And Marine Sediment

Source Dataset Sampling Location
Location NameJapan Sea near Toyama Prefecture, JAPAN
CoordinatesLat. (o)36.97018Long. (o)137.37008Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007417Metagenome351Y
F036651Metagenome / Metatranscriptome169N

Sequences

Protein IDFamilyRBSSequence
Ga0151675_10077364F036651AGGAMDIHLNEVGTTKPLILSKRSIRGYYKDFLTGETKVQVNDREYSVRDSLTEIQYLMGVNT*
Ga0151675_10077367F007417AGGAMTRYILQVQLPSLGWVVAIKTSDLFYMASKRARLIAEGHKVKLKREYK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.