Scaffold Ga0151675_1005557

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0151675_1005557

Scaffold Ga0151675_1005557

Overview

Basic Information
Taxon OID	3300011254 Open in IMG/M
Scaffold ID	Ga0151675_1005557 Open in IMG/M
Source Dataset Name	Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, 0.02
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Toyama Prefectural University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	7895
Total Scaffold Genes	24 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	16 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Environmental Dna From Seawater And Marine Sediment

Source Dataset Sampling Location
Location Name	Japan Sea near Toyama Prefecture, JAPAN
Coordinates	Lat. (^o)	36.97018	Long. (^o)	137.37008	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001277	Metagenome / Metatranscriptome	733	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0151675_10055577	F001277	AGGGGG	MKRPRRDKEHIAIRKKNNFEDRYAKGIHFDIRSKGSCFITMQTHAGPLEVYIDSMDGLDDAPYVSARIPDRKVKEFFVK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.