| Basic Information | |
|---|---|
| Taxon OID | 3300011253 Open in IMG/M |
| Scaffold ID | Ga0151671_1124240 Open in IMG/M |
| Source Dataset Name | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, permeate |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Toyama Prefectural University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1834 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Environmental Dna From Seawater And Marine Sediment |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Japan Sea near Toyama Prefecture, JAPAN | |||||||
| Coordinates | Lat. (o) | 37.04027 | Long. (o) | 137.37583 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F029927 | Metagenome | 187 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0151671_11242402 | F029927 | N/A | VGEITNQMQAVNTKSLFHNLTATLEKLDNDEIDVYKAAATANLVQQCGHLLNYELKRAALMTKPEFKAEHRNLESKNFDSIEQVKPKKLT* |
| ⦗Top⦘ |