Scaffold Ga0151657_1016523

Overview

Basic Information

• Taxon OID: 3300011247
• Scaffold ID: Ga0151657_1016523
• Source Dataset Name: Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_3, 0.02
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Toyama Prefectural University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 679
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Environmental Dna From Seawater And Marine Sediment

Source Dataset Sampling Location

• Location Name: Japan Sea near Toyama Prefecture, JAPAN
• Coordinates
  • Lat. (^o): 37.1316
  • Long. (^o): 137.71844

Associated Families

Family	Category	Number of Sequences	3D Structure?
F084115	Metagenome	112	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0151657_10165231	F084115	AGGA	MKKFKFHYNTIGDCFYDIYCQPNCTKKEDLLKDMAGILNGELTADDVAKEIIQWVGERSDEGYLDDDCQISTSREVKEGSVSVPIAKQGRS*