| Basic Information | |
|---|---|
| Taxon OID | 3300011246 Open in IMG/M |
| Scaffold ID | Ga0137490_1003415 Open in IMG/M |
| Source Dataset Name | Glacer surface microbial communities from an Arctic cyroconite hole, Midre Lovenbreen, Svalbard, Norway (Sample 22) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Bristol |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1926 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Unclassified → Unclassified → Unclassified → Cryoconite Hole, Glacier Surface → Metagenomes Of Arctic Soils |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Midre Lovenbreen Svalbard, Norway | |||||||
| Coordinates | Lat. (o) | 79.48416667 | Long. (o) | 12.09222222 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F042189 | Metagenome | 158 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0137490_10034152 | F042189 | GAGG | VAELYEVLLIDGGARWHVGWLVDDETETDLLLTDSGKVLLFGSRAALEHHAQEHRLALNDDLPDEVDLDLGGWLSEGAPEPSTAEVSELWHLLYDDPMAGGVLETEELGEAYDDLVEDVDDWFAQHGEAARRALASAVSRLRSAFRVV* |
| ⦗Top⦘ |