Scaffold Ga0137490_1001950

Overview

Basic Information

• Taxon OID: 3300011246
• Scaffold ID: Ga0137490_1001950
• Source Dataset Name: Glacer surface microbial communities from an Arctic cyroconite hole, Midre Lovenbreen, Svalbard, Norway (Sample 22)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Bristol
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2655
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (62.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Unclassified → Unclassified → Unclassified → Cryoconite Hole, Glacier Surface → Metagenomes Of Arctic Soils

Source Dataset Sampling Location

• Location Name: Midre Lovenbreen Svalbard, Norway
• Coordinates
  • Lat. (^o): 79.48416667
  • Long. (^o): 12.09222222
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F056330	Metagenome / Metatranscriptome	137	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0137490_10019503	F056330	AGG	MPVDALLSLQSTVTKTATFSGAALILPGGTPRRGLKARVFYSAAANATGANAVQFSIDVSYDGGVTWNSDFLAPALNLTTTAQAGELAIPFEVSPTSVVNQIQIRLTSLFGGAGTVPTVTYSSDGVMLSRP*