Scaffold Ga0136709_1028124

Overview

Basic Information

• Taxon OID: 3300011184
• Scaffold ID: Ga0136709_1028124
• Source Dataset Name: Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 777
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location

• Location Name: USA: Indian Creek, Illinois
• Coordinates
  • Lat. (^o): 41.6655
  • Long. (^o): -87.5437

Associated Families

Family	Category	Number of Sequences	3D Structure?
F073086	Metagenome	120	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0136709_10281241	F073086	GGA	MKYKNGQPVEHGDVVHVRNRPYTVYSISDTVTLRSMCERGYIKRVFPADIGAYIPRLHPLFAELMPL*