Scaffold Ga0136580_111200

Overview

Basic Information

• Taxon OID: 3300011171
• Scaffold ID: Ga0136580_111200
• Source Dataset Name: Saline lake microbial communities from Deep lake, Antarctica - Metagenome #285
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1189
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Idiomarinaceae → unclassified Idiomarinaceae → Idiomarinaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location

• Location Name: Antarctica: Deep lake
• Coordinates
  • Lat. (^o): -68.5558
  • Long. (^o): 78.1913

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030941	Metagenome	184	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0136580_1112003	F030941	GGTGG	VVIALAVLCALMALPSVLGLLVIFHVFVRSKNPPADTSNRINHFRLVWFALTREGLFVGLFPWLKNDEYDNVME*