| Basic Information | |
|---|---|
| Taxon OID | 3300011126 Open in IMG/M |
| Scaffold ID | Ga0151654_1107156 Open in IMG/M |
| Source Dataset Name | Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, 0.02 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Toyama Prefectural University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 562 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Coastal → Sediment → Marine → Environmental Dna From Seawater And Marine Sediment |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Japan Sea near Toyama Prefecture, JAPAN | |||||||
| Coordinates | Lat. (o) | 37.035 | Long. (o) | 137.41472 | Alt. (m) | Depth (m) | 803 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F034576 | Metagenome / Metatranscriptome | 174 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0151654_11071561 | F034576 | N/A | NIGKVIDPAKTTDPENPVYYPGWAYDIMSADDLDVGSNEVYPGDASAHQFYGFPRNTEVPPPIEEEEVISE* |
| ⦗Top⦘ |