| Basic Information | |
|---|---|
| Taxon OID | 3300011120 Open in IMG/M |
| Scaffold ID | Ga0150983_15619404 Open in IMG/M |
| Source Dataset Name | Combined assembly of Microbial Forest Soil metaT |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 774 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Harvard Forest Long Term Ecological Research (Lter) Site In Petersham, Ma, For Long-Term Soil Warming Studies |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Harvard Forest LTER, Petersham, MA, USA | |||||||
| Coordinates | Lat. (o) | 42.532967 | Long. (o) | -72.180244 | Alt. (m) | Depth (m) | 0 to .1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F051750 | Metagenome / Metatranscriptome | 143 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0150983_156194041 | F051750 | N/A | DIYRRFVRLADKIKHVEDHHLLELIRDTHKPAGSATPLIEPLQGAVAASANTPAQESPKAFPNPAPASSFGMSVPLAQEHHPEQEDYLWGV* |
| ⦗Top⦘ |