Scaffold Ga0105246_10006329

Overview

Basic Information

• Taxon OID: 3300011119
• Scaffold ID: Ga0105246_10006329
• Source Dataset Name: Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 7228
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location

• Location Name: Michigan, USA
• Coordinates
  • Lat. (^o): 42.3948
  • Long. (^o): -85.3738

Associated Families

Family	Category	Number of Sequences	3D Structure?
F080008	Metagenome / Metatranscriptome	115	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0105246_100063291	F080008	N/A	RSEAAGRGVATAFVIDTRNNQWWGIEAPSGWSLAAFDPNNPGALIASDTFPTGSGKTVFGPGSGYGSVLPAPFGTVPVVSSQDPTYPYCSFCDRMTGMGAIVFQPNGTASFVGSLPARPALGQQFTVESAADGRTVLFAIMGRTGMVEVFDR*