NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0151516_10973

Scaffold Ga0151516_10973


Overview

Basic Information
Taxon OID3300011116 Open in IMG/M
Scaffold IDGa0151516_10973 Open in IMG/M
Source Dataset NameFreshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Nov
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterChunlab, Inc
Sequencing StatusFinished

Scaffold Components
Scaffold Length (bps)12502
Total Scaffold Genes28 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)19 (67.86%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Viral Communities From Lake Soyang, Gangwon-Do, South Korea

Source Dataset Sampling Location
Location NameGangwon-do, South Korea
CoordinatesLat. (o)37.947421Long. (o)127.818872Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018928Metagenome / Metatranscriptome232Y

Sequences

Protein IDFamilyRBSSequence
Ga0151516_1097316F018928AGGGGGMLIRSLNTMEKIVSKNKNLIWNGWDIIDLKESDIAKTSPTGIRVKDKWYVHKIYSPGRNGWDIPNKYRD*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.