Basic Information | |
---|---|
Taxon OID | 3300011116 Open in IMG/M |
Scaffold ID | Ga0151516_10759 Open in IMG/M |
Source Dataset Name | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Nov |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Chunlab, Inc |
Sequencing Status | Finished |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 14805 |
Total Scaffold Genes | 27 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 19 (70.37%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Viral Communities From Lake Soyang, Gangwon-Do, South Korea |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Gangwon-do, South Korea | |||||||
Coordinates | Lat. (o) | 37.947421 | Long. (o) | 127.818872 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F046342 | Metagenome | 151 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0151516_1075923 | F046342 | N/A | MSCPWSLVSVHWIDAYDSDNGWIEIETYKPEACHVVSVGFLWPDCLPGYISITGSYMPDEVPNLKTIGMVTHIPVSMVQNVKVLDQAKIDLTLQHPPRML* |
⦗Top⦘ |