Scaffold Ga0151514_11064

Overview

Basic Information

• Taxon OID: 3300011115
• Scaffold ID: Ga0151514_11064
• Source Dataset Name: Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016May
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Chunlab, Inc
• Sequencing Status: Finished

Scaffold Components

• Scaffold Length (bps): 10613
• Total Scaffold Genes: 24
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (8.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Viral Communities From Lake Soyang, Gangwon-Do, South Korea

Source Dataset Sampling Location

• Location Name: Gangwon-do, South Korea
• Coordinates
  • Lat. (^o): 37.947421
  • Long. (^o): 127.818872
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F032099	Metagenome / Metatranscriptome	181	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0151514_110649	F032099	N/A	MDKIRGGARPNAGRKSKVEEQKVNNVFLKALGELYSKETEEDTKIAFVKDTLMQSQRGQLFIAEHIFGKPKEIIEATHNVNDFNIKDIFKVGNSNKSEI*