| Basic Information | |
|---|---|
| Taxon OID | 3300011115 Open in IMG/M |
| Scaffold ID | Ga0151514_10234 Open in IMG/M |
| Source Dataset Name | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016May |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Chunlab, Inc |
| Sequencing Status | Finished |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 27501 |
| Total Scaffold Genes | 44 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 36 (81.82%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Viral Communities From Lake Soyang, Gangwon-Do, South Korea |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Gangwon-do, South Korea | |||||||
| Coordinates | Lat. (o) | 37.947421 | Long. (o) | 127.818872 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F051937 | Metagenome | 143 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0151514_1023420 | F051937 | AGGAG | MTGEQIGGIVRALAAAIGGYFVGQGLVDAETVTTIGGAAATIAVAAWSIYAKRKA* |
| ⦗Top⦘ |