| Basic Information | |
|---|---|
| Taxon OID | 3300011114 Open in IMG/M |
| Scaffold ID | Ga0151515_10479 Open in IMG/M |
| Source Dataset Name | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016Feb |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Chunlab, Inc |
| Sequencing Status | Finished |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 17455 |
| Total Scaffold Genes | 30 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 23 (76.67%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfurellales → unclassified Desulfurellales → Desulfurellales bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Viral Communities From Lake Soyang, Gangwon-Do, South Korea |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Gangwon-do, South Korea | |||||||
| Coordinates | Lat. (o) | 37.947421 | Long. (o) | 127.818872 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F015857 | Metagenome / Metatranscriptome | 251 | Y |
| F059652 | Metagenome | 133 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0151515_1047922 | F015857 | GGA | MQSTSYSIADIEAFASRFYQGRALLITPYAYTITFAALAAATTASQVINIAANADFMALMFHHRATSAGAAQTVSNKIAPLVRILVTDSGSNEQFTNAAVDIENYSTNGNIVNDLPYPRIVSGRSTLTVQVTSYEASVSLNLDVSIEGVLVRAYS* |
| Ga0151515_1047927 | F059652 | GAGG | MSEPVERWHLKKEIQVTHVVSTLLLVGAVFAYVSKVDQRLTIVETQLIAQREASAVQRVQLERMDAKLDRLIERSK* |
| ⦗Top⦘ |