NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0138546_127830

Scaffold Ga0138546_127830


Overview

Basic Information
Taxon OID3300011032 Open in IMG/M
Scaffold IDGa0138546_127830 Open in IMG/M
Source Dataset NamePeat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 27 (Metagenome Metatranscriptome) (version 2)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)625
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil → Peatlands Soil Microbial Communities From Germany And Austria, That Are Sulfate Reducing

Source Dataset Sampling Location
Location NameGermany: Weissenstadt
CoordinatesLat. (o)50.13Long. (o)11.88Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000734Metagenome / Metatranscriptome915Y
F033813Metagenome / Metatranscriptome176Y

Sequences

Protein IDFamilyRBSSequence
Ga0138546_1278301F033813N/ASWDAGGGRKKIVGVPRIIPGDWVKVEPGWLVRPL*
Ga0138546_1278302F000734AGGCGGMERSIRGGHAATAGPVKTFREVGGVTNDAADLWMKGNLRVKRRDPWHWANAPSKAVADSALSGEDAEPKS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.