Scaffold Ga0114934_10498597

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0114934_10498597

Scaffold Ga0114934_10498597

Overview

Basic Information
Taxon OID	3300011013 Open in IMG/M
Scaffold ID	Ga0114934_10498597 Open in IMG/M
Source Dataset Name	Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	539
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli)

Source Dataset Sampling Location
Location Name	Kolumbo volcano, Aegean Sea
Coordinates	Lat. (^o)	36.5275	Long. (^o)	25.4914	Alt. (m)		Depth (m)	482
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F087028	Metagenome / Metatranscriptome	110	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0114934_104985972	F087028	N/A	VFVGGIAQIPSTNYSVSGNQITFGSPPPANDGTSNGHIITVVQNLQKLGE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.