| Basic Information | |
|---|---|
| Taxon OID | 3300011012 Open in IMG/M |
| Scaffold ID | Ga0150979_1567201 Open in IMG/M |
| Source Dataset Name | Marine surface microbial communities from Baltic Sea. Combined Assembly of 24 SPs |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Berlin Center for Genomics in Biodiversity Research (BeGenDiv) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 646 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → Pyramimonadophyceae → Pyramimonadales → Pyramimonadaceae → Pyramimonas → Pyramimonas incertae sedis → Pyramimonas obovata | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Pelagic → Unclassified → Marine → Marine Surface Microbial Communities From Baltic Sea - Bioacid_Cyano |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Baltic Sea | |||||||
| Coordinates | Lat. (o) | 57.32 | Long. (o) | 20.05 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F046824 | Metagenome / Metatranscriptome | 150 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0150979_15672011 | F046824 | N/A | CRSALAAALFCIVAGVALAEEDCDKMVCKDTLYGHVNYKAAKKPDGTCACVPYFLDGPCKDMKCKDGWLATVNNETDKCECINPCYGKQCTPPYLAVVDYTRQTEGSCKCVWPGDMHVPLPKNETSGGTEVEASDECAKMVCDTKFGFLKYKPEKQNGECKCLPFYKDGPCKDQVCPDGYLVLEKDGKCGCSNPCEGMVCEPPSSAMIDYIRETE |
| ⦗Top⦘ |