NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0150979_1082582

Scaffold Ga0150979_1082582


Overview

Basic Information
Taxon OID3300011012 Open in IMG/M
Scaffold IDGa0150979_1082582 Open in IMG/M
Source Dataset NameMarine surface microbial communities from Baltic Sea. Combined Assembly of 24 SPs
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBerlin Center for Genomics in Biodiversity Research (BeGenDiv)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)539
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Pelagic → Unclassified → Marine → Marine Surface Microbial Communities From Baltic Sea - Bioacid_Cyano

Source Dataset Sampling Location
Location NameBaltic Sea
CoordinatesLat. (o)57.32Long. (o)20.05Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F017317Metagenome / Metatranscriptome241Y

Sequences

Protein IDFamilyRBSSequence
Ga0150979_10825821F017317N/AMYCAATEADCPFVAAKKTLIKMAAKKEPCDGTPCPAGCCPEYDWFCCADNMYCAATEADCPFVAAKRTLIKMAAAKKVVLKKEPCDGTPCPAGCCPEYDWFCCADNMYCAATEADCPFVAAKKSLIKMAAKKEPCDGTPCPAGCCPEYDWFCCADNMYC

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.