NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0139556_1023103

Scaffold Ga0139556_1023103


Overview

Basic Information
Taxon OID3300011011 Open in IMG/M
Scaffold IDGa0139556_1023103 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMolecular Research LP (MR DNA)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)904
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Central Basin Lake Erie, Ontario, Canada

Source Dataset Sampling Location
Location NameOntario, Canada
CoordinatesLat. (o)41.825Long. (o)-82.975Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011383Metagenome / Metatranscriptome291Y
F018351Metagenome / Metatranscriptome235Y

Sequences

Protein IDFamilyRBSSequence
Ga0139556_10231031F018351GGAGGMASETIAYNRNDIRDILKAFKVMDAQATDEARIQSAALATYAAEEIKTAARGRTKSGKVAQRIADGVSISKSSKIGEFKY
Ga0139556_10231033F011383N/ATTNISGTFQLDMLADWGKASSVCEALWAAAETAPDTDISMTLTAASGAQFVFPVKPEFPTAGGSGIDAQTVSFTFTVSKGAVVETFS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.