| Basic Information | |
|---|---|
| Taxon OID | 3300011010 Open in IMG/M |
| Scaffold ID | Ga0139557_1059439 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Molecular Research LP (MR DNA) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 644 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater → Freshwater Microbial Communities From Central Basin Lake Erie, Ontario, Canada |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Ontario, Canada | |||||||
| Coordinates | Lat. (o) | 41.825 | Long. (o) | -82.975 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F014733 | Metagenome / Metatranscriptome | 260 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0139557_10594393 | F014733 | GGAG | MFEIWDGELFLYAVDTEYEADEHEAAGFTVKEISR* |
| ⦗Top⦘ |