Scaffold Ga0139557_1006994

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0139557_1006994

Scaffold Ga0139557_1006994

Overview

Basic Information
Taxon OID	3300011010 Open in IMG/M
Scaffold ID	Ga0139557_1006994 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Molecular Research LP (MR DNA)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2322
Total Scaffold Genes	11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	7 (63.64%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater → Freshwater Microbial Communities From Central Basin Lake Erie, Ontario, Canada

Source Dataset Sampling Location
Location Name	Ontario, Canada
Coordinates	Lat. (^o)	41.825	Long. (^o)	-82.975	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F070028	Metagenome	123	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0139557_10069947	F070028	GGAG	MNAPLDFDEKIFALQMYDRVAIVADLIMEHWLEGNANPPQDLINAYYDAVEGAQIAINGNRLHEQVVRPNAEFFEELHEKFGLTENKKKNLDNTPDLF*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.