Scaffold Ga0139362_1189299

Overview

Basic Information

• Taxon OID: 3300011008
• Scaffold ID: Ga0139362_1189299
• Source Dataset Name: Rumen microbial communities from healthy moose, Palmer, Alaska. Combined Assembly of Gp0161001, Gp0160600, Gp0160599, Gp0160598
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Ohio State University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1433
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Mammals → Digestive System → Foregut → Rumen → Moose Rumen → Rumen Microbial Communities From Healthy Moose, Palmer, Alaska

Source Dataset Sampling Location

• Location Name: Palmer, Alaska
• Coordinates
  • Lat. (^o): 61.5997
  • Long. (^o): -148.1128

Associated Families

Family	Category	Number of Sequences	3D Structure?
F053657	Metagenome / Metatranscriptome	141	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0139362_11892993	F053657	AGGA	VKNVASQVFEFLYKGQYMTKLFSHPKTWEENPILKNLVDNVPISDKKTQKSCDDVFYEYLQSFKDKTNEKYFILLIKFVLLFRECYDISKTKDVNEEEKKAWTDHTSPEGLPDLCNEFYGEFMDPNGFFGLDENERNEIIEIIQHFCIWLFKKEYTKSKLSLAN*