Basic Information | |
---|---|
Taxon OID | 3300011008 Open in IMG/M |
Scaffold ID | Ga0139362_1141920 Open in IMG/M |
Source Dataset Name | Rumen microbial communities from healthy moose, Palmer, Alaska. Combined Assembly of Gp0161001, Gp0160600, Gp0160599, Gp0160598 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Ohio State University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1757 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Moose Rumen → Rumen Microbial Communities From Healthy Moose, Palmer, Alaska |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Palmer, Alaska | |||||||
Coordinates | Lat. (o) | 61.5997 | Long. (o) | -148.1128 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F070738 | Metagenome / Metatranscriptome | 122 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0139362_11419202 | F070738 | AGAAGG | MLNFEDFLFVLRGKPNEERQAVIDYVYSIFDKEHTGVADANEMKKVFNCQKHPKFTMGKLTETQMFYLYLKNFNHNVKMTVTKKVNIFFYNFF* |
⦗Top⦘ |