| Basic Information | |
|---|---|
| Taxon OID | 3300011007 Open in IMG/M |
| Scaffold ID | Ga0139299_1128919 Open in IMG/M |
| Source Dataset Name | Basal ice microbial communities from Matanuska glacier, Alaska, USA - MataB |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Tsinghua University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1622 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Ice → Glacier → Basal Ice → Basal Ice Microbial Communities From Matanuska Glacier, Alaska, Usa - Matab |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Matanuska glacier, Alaska, USA | |||||||
| Coordinates | Lat. (o) | 61.6558 | Long. (o) | 147.5811 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F050966 | Metagenome / Metatranscriptome | 144 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0139299_11289191 | F050966 | GAGG | MSGSRWQGMKTRYGDGTEALSEEMESNRSATPKSRRHRLTLPPDWWDSARF |
| ⦗Top⦘ |