Scaffold Ga0139320_1083347

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0139320_1083347

Scaffold Ga0139320_1083347

Overview

Basic Information
Taxon OID	3300011006 Open in IMG/M
Scaffold ID	Ga0139320_1083347 Open in IMG/M
Source Dataset Name	Rumen fluid microbial communities from healthy moose, Palmer, Alaska - F08
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Ohio State University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1253
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Moose Rumen → Rumen Microbial Communities From Healthy Moose, Palmer, Alaska

Source Dataset Sampling Location
Location Name	Palmer, Alaska
Coordinates	Lat. (^o)	61.5997	Long. (^o)	-148.1128	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F022112	Metagenome / Metatranscriptome	216	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0139320_10833472	F022112	N/A	MTDKFEKEIISEINSFRSNPRSIQHQIEVLQKGISRLRSNDPFLKEIDNFINSIDRIPKMNPLVVNKTLNQIAREEVKKYIRNETNYNPYLTGAQLKGIVPPGFLEQNAALIADSGADEAETVVPKLLLNKLDVEKKGRKILCTPDYTQIGIASRESEGENYYVILFANNDSVEEGDPQLPPGDLTELKQAFDLYDHDGSQKIRIRECLEGMKSVNFDKTNPILFENEVC*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.