Scaffold Ga0139361_1208353

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0139361_1208353

Scaffold Ga0139361_1208353

Overview

Basic Information
Taxon OID	3300011005 Open in IMG/M
Scaffold ID	Ga0139361_1208353 Open in IMG/M
Source Dataset Name	Rumen fluid microbial communities from healthy moose, Palmer, Alaska- post 0.2 um filtrate
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Ohio State University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	505
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Moose Rumen → Rumen Microbial Communities From Healthy Moose, Palmer, Alaska

Source Dataset Sampling Location
Location Name	Palmer, Alaska
Coordinates	Lat. (^o)	61.5997	Long. (^o)	-148.1128	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F021029	Metagenome / Metatranscriptome	220	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0139361_12083532	F021029	N/A	GKFQPVKTRIRQLEKDIAELRGNLNENKKAGMVIKGELAVLETTIKEKCNELCKCIMDDLTNFDKDLKRVIQNDRTETDFFKVQTNSLNDDKIKLQKETISLQSRMRNCEIDIGVEPKS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.