NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0138513_100026056

Scaffold Ga0138513_100026056


Overview

Basic Information
Taxon OID3300011000 Open in IMG/M
Scaffold IDGa0138513_100026056 Open in IMG/M
Source Dataset NameAgricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterShell Corporation
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)831
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil → Subsurface Hydrocarbon Microbial Communities From Various Worldwide Shell Locations

Source Dataset Sampling Location
Location NameRanch near Red Deer, Alberta, Canada
CoordinatesLat. (o)52.172047Long. (o)-113.738964Alt. (m)Depth (m).15
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F041335Metagenome / Metatranscriptome160Y

Sequences

Protein IDFamilyRBSSequence
Ga0138513_1000260562F041335N/AMLILLTSEGTALRKAADERMLRREQTRPTRRGIEGIRGTGSMEVSGEARDRGIEEWRLWAALPPLGAAPRAP*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.