| Basic Information | |
|---|---|
| Taxon OID | 3300010995 Open in IMG/M |
| Scaffold ID | Ga0139323_147053 Open in IMG/M |
| Source Dataset Name | ECM14MPS05_Aassembled -- Sediment microbial communities from coastal marsh in Port Sulphur, LA sequencing method A (2X250bp) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Molecular Research LP (MR DNA) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 709 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment → Cwc Coastal Marshes |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Louisiana, Port Sulphur, Bay Sansbois east | |||||||
| Coordinates | Lat. (o) | 29.45083 | Long. (o) | -89.75005 | Alt. (m) | Depth (m) | 0 to .02 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F031466 | Metagenome / Metatranscriptome | 182 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0139323_1470532 | F031466 | N/A | MTEKSLVMNLVVLGFLMLCVAGIIVGGYIHGDMHFAKVLEHLKK* |
| ⦗Top⦘ |