Scaffold Ga0138321_10228311

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0138321_10228311

Scaffold Ga0138321_10228311

Overview

Basic Information
Taxon OID	3300010980 Open in IMG/M
Scaffold ID	Ga0138321_10228311 Open in IMG/M
Source Dataset Name	Metatranscriptome of Cow rumen microbial communities from the University of Illinois at Urbana-Champaign, USA - Cow X-1 corn stover (Eukaryote Community Metatranscriptome) (version 8)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	750
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Unclassified → Fungi-Associated Bovine Rumen → Fungi-Associated Bovine Rumen Microbial Communities From The University Of Illinois At Urbana-Champaign, Usa, For Metatranscriptome Analysis

Source Dataset Sampling Location
Location Name	USA: Illinois
Coordinates	Lat. (^o)	40.102108	Long. (^o)	-88.227299	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F006970	Metagenome / Metatranscriptome	361	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0138321_102283111	F006970	N/A	KTMKKPIESDNPLLNKKIVKSTLKTHAYSTPWDQPQYKEQIVSNQKYSKIENVFEIPYLKHIPAYKTGSDFFTRFNMCIEKKKNLKKTLDDITKRYNDIMAIFNKELDKTFAGSPTQEQKERMMEYIIKMLELYHEFREVEHYDDIFSKEVEKTNMTFSGAQKEKFEDGMAILKKGFPFQLTVTYSKMNDDFRKIINRCFLEKNMRFYKPKEIADVTLYKEYSCIRLIK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.