Scaffold Ga0138321_10018843

Overview

Basic Information

• Taxon OID: 3300010980
• Scaffold ID: Ga0138321_10018843
• Source Dataset Name: Metatranscriptome of Cow rumen microbial communities from the University of Illinois at Urbana-Champaign, USA - Cow X-1 corn stover (Eukaryote Community Metatranscriptome) (version 8)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2203
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Mammals → Digestive System → Foregut → Unclassified → Fungi-Associated Bovine Rumen → Fungi-Associated Bovine Rumen Microbial Communities From The University Of Illinois At Urbana-Champaign, Usa, For Metatranscriptome Analysis

Source Dataset Sampling Location

• Location Name: USA: Illinois
• Coordinates
  • Lat. (^o): 40.102108
  • Long. (^o): -88.227299

Associated Families

Family	Category	Number of Sequences	3D Structure?
F045434	Metagenome / Metatranscriptome	153	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0138321_100188431	F045434	AGGA	LKNKKNSTHFIGILNSLLERNGYGINFYKNGEKYIGYFEHDLPNKNGIYIWSPTIKGRNIHFECYQGLWKNNQKEKNGIYIWLNEPLNNKEFDNADFDAYVGIFDKDKYVKGTYLSKIKDDYYLYHGGFDKDGKKCDDNAFFYSSKYDRILKGKIEKDVFINAYVAFFESDSGEIKNLVKCDFNKKGNVESIILMNDLKEEEKNKEEKEITLFRNVILEIDYFGIIYERFHEIKDFIRDNINSVEIFEDKNKFPNLMNLCSKHG