| Basic Information | |
|---|---|
| Taxon OID | 3300010970 Open in IMG/M |
| Scaffold ID | Ga0137575_10000026 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1, april 2016 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | FASTERIS |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 36760 |
| Total Scaffold Genes | 57 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 34 (59.65%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water → Freshwater Microbial Communities From The Surface Of The Forest Pond In Jussy, Geneva, Switzerland |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Jussy, Geneva, SWITZERLAND | |||||||
| Coordinates | Lat. (o) | 46.25 | Long. (o) | 6.28 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F043944 | Metagenome | 155 | Y |
| F092064 | Metagenome / Metatranscriptome | 107 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0137575_100000261 | F092064 | N/A | MKKAPKQIIGFLRNPETWDANVFETAIRNEVENSTGALTASDELLVGSLVLVVDTLVQAHIGLLENGAIYHYNAGDAPSPYYKIRTESMDKAIKILAELALVARGRPKIKNKVSEVDELFATA* |
| Ga0137575_1000002614 | F043944 | N/A | MIFNGHTLDTIEELDDVTLANIQTMYADGMVGNYGILTQIASLTNGVFNYMRPASSPPYKLANILGSAYDYIYPPLTAEQQKAAVNDSLLAFMSQANGFDKTKFGVKDG* |
| ⦗Top⦘ |