| Basic Information | |
|---|---|
| Taxon OID | 3300010967 Open in IMG/M |
| Scaffold ID | Ga0139247_1076535 Open in IMG/M |
| Source Dataset Name | Microbial communities from the inside layer of the microbial mat covering an inactive hydrothermal chimney from the Kolumbo submarine volcano, Santorini, Greece - V16_c.in |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Hellenic Centre for Marine Research (HCMR) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 868 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Chimney Microbial Mat → Inactive Hydrothermal Chimney Metagenome Study |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Kolumbo submarine Volcano, Hellenic Volcanic Arc, Aegean Sea, Greece | |||||||
| Coordinates | Lat. (o) | 36.52 | Long. (o) | 25.48 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F005815 | Metagenome / Metatranscriptome | 389 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0139247_10765351 | F005815 | N/A | EPAMTMNSTRLTTYWTIDDAATVIDFLDLLRDALWETYGDQITQMYREAYDDRFQDPNQCELEFDDDIPF* |
| ⦗Top⦘ |