Basic Information | |
---|---|
Taxon OID | 3300010966 Open in IMG/M |
Scaffold ID | Ga0137675_1007905 Open in IMG/M |
Source Dataset Name | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1bis, april 2016 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | FASTERIS |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 818 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water → Freshwater Microbial Communities From The Surface Of The Forest Pond In Jussy, Geneva, Switzerland |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Jussy, Geneva, SWITZERLAND | |||||||
Coordinates | Lat. (o) | 46.25 | Long. (o) | 6.28 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F003888 | Metagenome / Metatranscriptome | 463 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0137675_10079052 | F003888 | N/A | MDVVQEIETIETDVKDCDEKCKKVNCYALYDAIIASLKVLYDLIFLCCKKKD* |
⦗Top⦘ |