Scaffold Ga0137675_1006913

Overview

Basic Information

• Taxon OID: 3300010966
• Scaffold ID: Ga0137675_1006913
• Source Dataset Name: Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1bis, april 2016
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: FASTERIS
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 864
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → unclassified Nitrososphaeria → Nitrososphaeria archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water → Freshwater Microbial Communities From The Surface Of The Forest Pond In Jussy, Geneva, Switzerland

Source Dataset Sampling Location

• Location Name: Jussy, Geneva, SWITZERLAND
• Coordinates
  • Lat. (^o): 46.25
  • Long. (^o): 6.28

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030374	Metagenome	185	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0137675_10069132	F030374	N/A	MSKRLPGLVIEVENLAGFLAKPDEDILQHVRAVLLHRAYAVQRAQLAKCDGVQFSPTKDSCVFAAKGRALLHVRFAQLKA*