| Basic Information | |
|---|---|
| Taxon OID | 3300010966 Open in IMG/M |
| Scaffold ID | Ga0137675_1001474 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1bis, april 2016 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | FASTERIS |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1690 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water → Freshwater Microbial Communities From The Surface Of The Forest Pond In Jussy, Geneva, Switzerland |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Jussy, Geneva, SWITZERLAND | |||||||
| Coordinates | Lat. (o) | 46.25 | Long. (o) | 6.28 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F076852 | Metagenome | 117 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0137675_10014743 | F076852 | N/A | MLMVYVDRLKKDGSNKNVKLLGKGILTLVDHLFWNLPFCSVKQSQAVRKKAGVTEEEWSTKWEEIVAEHDLPGAREQLASGWKEYLGMRAGAAAARGAGAVRPASLSTVVLDTP* |
| ⦗Top⦘ |