Scaffold Ga0137675_1000112

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0137675_1000112

Scaffold Ga0137675_1000112

Overview

Basic Information
Taxon OID	3300010966 Open in IMG/M
Scaffold ID	Ga0137675_1000112 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1bis, april 2016
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	FASTERIS
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	7505
Total Scaffold Genes	12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	9 (75.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water → Freshwater Microbial Communities From The Surface Of The Forest Pond In Jussy, Geneva, Switzerland

Source Dataset Sampling Location
Location Name	Jussy, Geneva, SWITZERLAND
Coordinates	Lat. (^o)	46.25	Long. (^o)	6.28	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F006740	Metagenome	365	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0137675_10001122	F006740	GGAG	MPTFESWSHENLANFAKESYAKLQEQQDYIEQLQNDLKDAINAYRSLIK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.