 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300010965 Open in IMG/M |
| Scaffold ID | Ga0138308_148984 Open in IMG/M |
| Source Dataset Name | Microbial communities from Lake Cadagno chemocline, Switzerland. Combined Assembly of Gp0156211, Gp0156621 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Max Planck Institute for Marine Microbiology, Max Planck Institute for Plant Breeding Research |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1722 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Skeletonemataceae → Skeletonema → Skeletonema marinoi-dohrnii complex → Skeletonema marinoi | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Chemocline → Microbial Communities From Lake Cadagno Chemocline, Switzerland. |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lake Cadagno, Switzerland | |||||||
| Coordinates | Lat. (o) | 46.5499 | Long. (o) | 8.711 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F062459 | Metagenome / Metatranscriptome | 130 | Y |
| F082155 | Metagenome / Metatranscriptome | 113 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0138308_1489841 | F082155 | AGG | VYLNFAKKHGIQDPCGSEPGYQRIIACFAEQLMIDHNSRSATVRGYVDSINTLFKLRNFDPPADLSDRANMCTKIIVAREKEECIARQRSPITREIYSALLDQAKKSLVDSVETVVFDWFTLIRITGLRCAEYAQKNQTNVEEHEYASGKRVVKAFVPSDWKFYNSKGRLITDPMEVPIKLKMTFRIQKNRQNGQSITLVFDVDHHDICAVRAAYRIYLRAIRLGQSDSEPMGIFVNKFGIKKYLTGGKIAEILRSVAKRVHPDWSSDELSRISSHSGRVWALVLLDEAGMSPAFMTSRLRWMGDSYKLYLRDTSILQHKHIDALKKESDELMKLLGTNKNVLPNVVPVDNDMGDY* |
| Ga0138308_1489842 | F062459 | N/A | SSKRINDDPHPVVLCVTDNTSALNWTLHTSKKSRIGRALARFFCGLLIGSHVGINAKWISTVENEIADKISRLKKLTPSEIKLSSSHDTYDYAKLQQEHKELKACNSFQPSHKLVSLLLEILLTGNCPDLKQILKLRPQDLGKLCI* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |