| Basic Information | |
|---|---|
| Taxon OID | 3300010945 Open in IMG/M |
| Scaffold ID | Ga0139174_119608 Open in IMG/M |
| Source Dataset Name | Wastewater viral communities and vesicles from water purifying plant in Alicante,Spain - replicate C2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Autonomous University of Barcelona |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 799 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Wastewater → Wastewater Viral Communities And Vesicles From Water Purifying Plant In Alicante,Spain |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Alicante,Spain | |||||||
| Coordinates | Lat. (o) | 38.34 | Long. (o) | -0.48 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F082719 | Metagenome / Metatranscriptome | 113 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0139174_1196082 | F082719 | AGGAG | MARGSDFITLARQHNKNIWDGINALVALQREWNALDYGNTLPDGDGANSEYTADEVGAVVFDTANAFVAVLGAGHATNMAKLL* |
| ⦗Top⦘ |