| Basic Information | |
|---|---|
| Taxon OID | 3300010945 Open in IMG/M |
| Scaffold ID | Ga0139174_115584 Open in IMG/M |
| Source Dataset Name | Wastewater viral communities and vesicles from water purifying plant in Alicante,Spain - replicate C2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Autonomous University of Barcelona |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 914 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Wastewater → Wastewater Viral Communities And Vesicles From Water Purifying Plant In Alicante,Spain |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Alicante,Spain | |||||||
| Coordinates | Lat. (o) | 38.34 | Long. (o) | -0.48 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F049646 | Metagenome / Metatranscriptome | 146 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0139174_1155842 | F049646 | N/A | MAHNTNKPLTPALRKATVISSCDCLVGFLSGEKVNKSTIDYEVEQIVNIQPAFKKYGLLNGEPQTKRQIVDGRKGYLSRFVYCPYCGEKINWKQVLSNCL* |
| ⦗Top⦘ |