Scaffold Ga0138501_119159

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0138501_119159

Scaffold Ga0138501_119159

Overview

Basic Information
Taxon OID	3300010944 Open in IMG/M
Scaffold ID	Ga0138501_119159 Open in IMG/M
Source Dataset Name	Wastewater viral communities and vesicles from water purifying plant in Alicante,Spain - replicate Ab1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Autonomous University of Barcelona
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	774
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Wastewater → Wastewater Viral Communities And Vesicles From Water Purifying Plant In Alicante,Spain

Source Dataset Sampling Location
Location Name	Alicante,Spain
Coordinates	Lat. (^o)	38.34	Long. (^o)	-0.48	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002371	Metagenome / Metatranscriptome	566	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0138501_1191593	F002371	N/A	MKLQRKKKEARGGTRKNAGAKPKYSEQTKTVAFRCPLSKVDEIKVIVKSKFSEWLVK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.